optimizedshieldaccuratereliable.autos
optimizedshieldaccuratereliable.autos: 1 active listing(s), best offer Auction at $15. Namester Score 19/100.
19AuctionBest price $15 on Namecheap
Offers across sources (1)
| Source | Type | Price | Bids | Ends | |
|---|---|---|---|---|---|
| Namecheap | Auction | $15 | 0 | Buy on Namecheap |
Namester Score
19
Computed from extension demand, name length, format and age; SEO authority adds a small bonus.
- Extension demand
- 25
- Name length
- 44
- Age
- n/a
- Format
- 100%
- Intrinsic quality
- 22
- Authority bonus
- 0
- Confidence
- 20
Evidence: prior · v2
Price history
| Date | Source | Event | Price | Bids |
|---|---|---|---|---|
| 2026-11-08 14:06 | Namecheap | Listed | $15 | 0 |
Showing the last 7 days of price history. Upgrade for a longer history
Comparable sales
Ended listings in the same extension with the same name length, last 2 years.
| Domain | Price | Result | Source | Date |
|---|---|---|---|---|
| top-application-protect-private.autos | $15 | Not sold | Namecheap | 2026-10-29 |
| smartfreespecialofferinstantwin.autos | $15 | Not sold | Namecheap | 2026-10-28 |
| proactive-fast-advanced-defense.autos | $15 | Not sold | Namecheap | 2026-10-22 |
| proactivefastadvancedprotection.autos | $15 | Not sold | Namecheap | 2026-10-22 |
| techieinstallsapplicationonline.autos | $15 | Not sold | Namecheap | 2026-10-21 |
| advanced-reliable-smart-defense.autos | $15 | Not sold | Namecheap | 2026-10-19 |
| installs-application-new-mobile.autos | $15 | Not sold | Namecheap | 2026-10-19 |
| optimizedadvancedcyberbrilliant.autos | $2 | Not sold | Namecheap | 2026-10-15 |
| reliableshieldaccurateproactive.autos | $15 | Not sold | Namecheap | 2026-10-12 |
| protectonlineapplicationprivacy.autos | $15 | Not sold | Namecheap | 2026-10-06 |
| immediateinternetdetectedcopier.autos | $2 | Not sold | Namecheap | 2026-10-04 |
| radiator-chassis-winglet-airbox.autos | $15 | Not sold | Namecheap | 2026-10-03 |
| best-application-mobile-protect.autos | $15 | Not sold | Namecheap | 2026-10-03 |
| specialoffer-congrats-real-draw.autos | $15 | Not sold | Namecheap | 2026-09-25 |
| smart-prize-instantwin-giveaway.autos | $15 | Not sold | Namecheap | 2026-09-25 |
| safetyriskfreeprivacyinstantwin.autos | $1 | Sold | Namecheap | 2026-09-25 |
| specialofferluckybigwinchampion.autos | $15 | Not sold | Namecheap | 2026-09-24 |
| lucky-foryou-instantwin-instant.autos | $15 | Not sold | Namecheap | 2026-09-24 |
| champion-weekly-congrats-reward.autos | $15 | Not sold | Namecheap | 2026-09-24 |
| specialoffer-foryou-deal-bigwin.autos | $15 | Not sold | Namecheap | 2026-09-24 |
Attributes
- Length
- 31
- Extension
- .autos
- Extension group
- New gTLD
- Words
- —
- Pattern
- —
- Hyphen
- No
- Digits
- No
- IDN
- No
- Age
- —
- First archived
- —
- First seen by us
- 2026-11-08
- Updated
- 2026-11-08 14:07 UTC
SEO metrics
No SEO metrics recorded for this name.
Other extensions of “optimizedshieldaccuratereliable”
No other extensions in our database.
Similar names
- reliableaccurateoptimizedshield.autos$1519
- accurate-shield-reliable-optimized.autos$114
- reliable-accurate-optimized-shield.autos$1514
- optimizedaccuratecyberreliable.autos$117
- accurateshieldreliableoptimized.autos$117
- accurateoptimizedsafereliable.autos$117
- accurateoptimizedsecurereliable.autos$117
- optimizedshieldlightweightreliable.autos$117
- accurate-optimized-safe-reliable.autos$114
- optimized-accurate-cyber-reliable.autos$114
- accurate-cyber-reliable-optimized.autos$114
- optimizedaccuratesmartshield.autos$1519