elitehighperformanceexecutivecoaching.com
elitehighperformanceexecutivecoaching.com: 1 active listing(s), best offer Auction at $15. Namester Score 34/100.
34AuctionBest price $15 on Namecheap
Offers across sources (1)
| Source | Type | Price | Bids | Ends | |
|---|---|---|---|---|---|
| Namecheap | Auction | $15 | 0 | Buy on Namecheap |
Namester Score
34
Computed from extension demand, name length, format and age; SEO authority adds a small bonus.
- Extension demand
- 100
- Name length
- 44
- Age
- 8
- Format
- 100%
- Intrinsic quality
- 19
- Authority bonus
- 0
- Confidence
- 60
Evidence: partial · v2
Price history
| Date | Source | Event | Price | Bids |
|---|---|---|---|---|
| 2026-11-08 05:06 | Namecheap | Listed | $15 | 0 |
Showing the last 7 days of price history. Upgrade for a longer history
Comparable sales
Ended listings in the same extension with the same name length, last 2 years.
| Domain | Price | Result | Source | Date |
|---|---|---|---|---|
| holisticeducationallearningpublishing.com | $1 | Not sold | GoDaddy | 2026-11-08 |
| shopdwinandflyatmarketplaceleichhardt.com | $5 | — | GoDaddy | 2026-11-08 |
| motivational-speaker-kevelin-robinson.com | $40 | — | GoDaddy | 2026-11-08 |
| xn--12cfu4bgcub2ff4b7hpafb7ize6ctc3fm.com | $50 | — | GoDaddy | 2026-11-08 |
| creativearrangementsproactiveservices.com | $11 | — | GoDaddy | 2026-11-08 |
| destinationweddingphotographernearyou.com | $40 | — | GoDaddy | 2026-11-08 |
| businesssecuritycamerasoforangecounty.com | $1 | Not sold | GoDaddy | 2026-11-08 |
| anotherqualityundertakingaccomplished.com | $5 | — | GoDaddy | 2026-11-08 |
| dixielandprecisionhaulingandlogistics.com | $50 | — | GoDaddy | 2026-11-08 |
| mobilehomelevelingandanchoringservice.com | $1 | Not sold | GoDaddy | 2026-11-08 |
| ajqbfmmcdsfelaxugkqcacgdoyemuktsxnlwe.com | $30 | — | GoDaddy | 2026-11-08 |
| lahainahawaiioceanfrontvacationrental.com | $5 | — | GoDaddy | 2026-11-08 |
| theolivetreemediterraneangrillhouston.com | $40 | — | GoDaddy | 2026-11-08 |
| trustedwealthadvicemeetstrustedvalues.com | $1 | Not sold | GoDaddy | 2026-11-08 |
| suzukimotorcyclelalbahadurcollegeroad.com | $50 | — | GoDaddy | 2026-11-08 |
| leadingindustrialelectricalcontractor.com | $5 | — | Dynadot | 2026-11-08 |
| 6431preservationparkwaystlhomeforsale.com | $50 | — | GoDaddy | 2026-11-08 |
| groupgrampanchayatlalpadichehadukhurd.com | $5 | — | GoDaddy | 2026-11-08 |
| bestforyourbuckheavyequipmentservices.com | $50 | — | GoDaddy | 2026-11-08 |
| qsdfcvtyuiertfghjiolkjertgfcfghjnmkiu.com | $40 | — | GoDaddy | 2026-11-08 |
Attributes
- Length
- 37
- Extension
- .com
- Extension group
- Classic gTLD
- Words
- —
- Pattern
- —
- Hyphen
- No
- Digits
- No
- IDN
- No
- Age
- 1
- First archived
- —
- First seen by us
- 2026-11-08
- Updated
- 2026-11-08 05:10 UTC
SEO metrics
- Backlinks
- 713
- DR
- —
- TF
- —
- CF
- —
- Traffic
- —
- Search volume
- —
- Top-sites rank
- —
- Archive snapshots
- —
- TLDs taken
- —
Other extensions of “elitehighperformanceexecutivecoaching”
No other extensions in our database.